PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI07G17960.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 327aa    MW: 36647.7 Da    PI: 10.2394
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI07G17960.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF984e-3163112251
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                      rienk+nrqvtfskRrng+lKKA+E+SvLCda+va+i+fs++gklye+ss
  OMERI07G17960.2  63 RIENKINRQVTFSKRRNGLLKKAHEISVLCDADVALIVFSTKGKLYEFSS 112
                      8***********************************************96 PP

2K-box921e-301372251098
            K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                      +++++e++  e+  Lk++++ Lq++qR+llGe+L++L+ keLqqLe+qLe slk+iRskKn+ll+e+i+elqkkek+l+++n+ L+k +
  OMERI07G17960.2 137 NTEDQENWGDEYGILKSKLDALQKTQRQLLGEQLDTLTTKELQQLEHQLEYSLKHIRSKKNQLLFESISELQKKEKSLKNQNNVLQKLM 225
                      467789*****************************************************************************998755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.3E-3954113IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.08554114IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-3355144IPR002100Transcription factor, MADS-box
CDDcd002653.18E-4255127No hitNo description
PRINTSPR004042.4E-305676IPR002100Transcription factor, MADS-box
PfamPF003193.3E-2663110IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-307691IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-3091112IPR002100Transcription factor, MADS-box
PfamPF014863.8E-27138224IPR002487Transcription factor, K-box
PROSITE profilePS5129715.869141232IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MATPHLHPHL KPPSLPLPLS SSPHFHLPRA LHPPPATATA TAAAFATAAD EERMGRGPVQ  60
LRRIENKINR QVTFSKRRNG LLKKAHEISV LCDADVALIV FSTKGKLYEF SSHSSMEGIL  120
ERYQRYSFDE RAVLEPNTED QENWGDEYGI LKSKLDALQK TQRQLLGEQL DTLTTKELQQ  180
LEHQLEYSLK HIRSKKNQLL FESISELQKK EKSLKNQNNV LQKLMETEKE KKNNAIITTH  240
REEQNGATPS TSSPTPVAAP DPIPTTNNRL PLSITSKPTK RIRGVRSSTV SGTSRQQQAS  300
AMDAPDKSHM KASVDLKQTQ KPILPPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1c7u_A2e-1855127172MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM
1c7u_B2e-1855127172MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0647040.0AK064704.1 Oryza sativa Japonica Group cDNA clone:002-118-A02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647484.11e-150PREDICTED: MADS-box transcription factor 18
SwissprotA2YNI21e-152MAD18_ORYSI; MADS-box transcription factor 18
SwissprotQ0D4T41e-152MAD18_ORYSJ; MADS-box transcription factor 18
TrEMBLA0A0E0EE400.0A0A0E0EE40_9ORYZ; Uncharacterized protein
STRINGBGIOSGA026097-PA1e-151(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP115137113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.14e-75MIKC_MADS family protein